| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344560.1 | complete | 101 | 234-539(+) |
Amino Acid sequence : | |||
| MKMPWRSNTNHKDCGICLMRHMETYTGQNVKDWKSGLTSRSKKQYRFLRAKYCSLILVADTNKLRWESKIAANDYFKKATKNMGKKIDMEKYIFDYLKIGD* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 12,025.947 | ||
| Theoretical pI: | 9.789 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
| Instability index: | 34.515 | ||
| aromaticity | 0.119 | ||
| GRAVY | -0.828 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.178 | ||
| sheet | 0.208 | ||