| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344564.1 | 5prime_partial | 223 | 1-672(+) |
Amino Acid sequence : | |||
| ARTVVHHCLLALPGVRTEYLTRVISHPQALSQCEHTLTKMGLNVIREAVDDTAGAAEYIAMNGLRDTAAIASARAAELYGLQILADGIQDDSGNVTRFVMLAREPIIPRIDRPFKTSIVF AHEKGTSVLFKVLSAFAFRNISLTKIESRPHRHRPIRLVDDANVGTAKHFEYMFYVDFEASMADVRAQNALAEVQEFTSFLRVLGSYPMDMTPWTPSSSAAGD* | |||
Physicochemical properties | |||
| Number of amino acids: | 223 | ||
| Molecular weight: | 24,664.920 | ||
| Theoretical pI: | 6.483 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 25.788 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.022 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.188 | ||
| sheet | 0.296 | ||