Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344564.1 | 5prime_partial | 223 | 1-672(+) |
Amino Acid sequence : | |||
ARTVVHHCLLALPGVRTEYLTRVISHPQALSQCEHTLTKMGLNVIREAVDDTAGAAEYIAMNGLRDTAAIASARAAELYGLQILADGIQDDSGNVTRFVMLAREPIIPRIDRPFKTSIVF AHEKGTSVLFKVLSAFAFRNISLTKIESRPHRHRPIRLVDDANVGTAKHFEYMFYVDFEASMADVRAQNALAEVQEFTSFLRVLGSYPMDMTPWTPSSSAAGD* | |||
Physicochemical properties | |||
Number of amino acids: | 223 | ||
Molecular weight: | 24,664.920 | ||
Theoretical pI: | 6.483 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
Instability index: | 25.788 | ||
aromaticity | 0.081 | ||
GRAVY | -0.022 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.188 | ||
sheet | 0.296 |