Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344579.1 | internal | 204 | 613-2(-) |
Amino Acid sequence : | |||
TGSTAALVVDKLGALLKSGALSDIVGVPTSKRTQEQAAALGIPLSTLDAHPHIDLAIDGADEVDPNLDLVKGRGGALLREKMVEAASDKFVVVVDDSKLVLGLGGSGLAMPVEVVQFCWN YNLVRLQDLFKEEGCDAKLRLDGDGKPYVTDNSNYIVDLYFKTPIKDSAAAGKEIAALEGVVEHGLFLGMTTAVIIAGGSGVTV | |||
Physicochemical properties | |||
Number of amino acids: | 204 | ||
Molecular weight: | 11,074.303 | ||
Theoretical pI: | 6.513 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 61.143 | ||
aromaticity | 0.040 | ||
GRAVY | -0.394 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.277 | ||
sheet | 0.178 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344579.1 | 5prime_partial | 103 | 615-304(-) |
Amino Acid sequence : | |||
APVPPPPWSSTSSAPSSNPAPSPTSSASPPPSAPRSRPPPSASPSPPSTPTPTSTSPSTAPTRSTPISTSSRAAAAPSSARRWWRRPPISLLSSSTTLNWYWG* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,074.303 | ||
Theoretical pI: | 6.513 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 61.143 | ||
aromaticity | 0.040 | ||
GRAVY | -0.394 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.277 | ||
sheet | 0.178 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344579.1 | 5prime_partial | 101 | 2-307(+) |
Amino Acid sequence : | |||
DGDSTPTGNNNRGGHTQEQAVLHHPFQGGDLLPGGGGILDRSLEVQIHNVVRVIRHVRLPVAVQSQLGVAPFFLEQILQPDQIIVPAELHHFHRHRQPGPT* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,074.303 | ||
Theoretical pI: | 6.513 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 61.143 | ||
aromaticity | 0.040 | ||
GRAVY | -0.394 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.277 | ||
sheet | 0.178 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344579.1 | internal | 204 | 613-2(-) |
Amino Acid sequence : | |||
TGSTAALVVDKLGALLKSGALSDIVGVPTSKRTQEQAAALGIPLSTLDAHPHIDLAIDGADEVDPNLDLVKGRGGALLREKMVEAASDKFVVVVDDSKLVLGLGGSGLAMPVEVVQFCWN YNLVRLQDLFKEEGCDAKLRLDGDGKPYVTDNSNYIVDLYFKTPIKDSAAAGKEIAALEGVVEHGLFLGMTTAVIIAGGSGVTV | |||
Physicochemical properties | |||
Number of amino acids: | 204 | ||
Molecular weight: | 11,074.303 | ||
Theoretical pI: | 6.513 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 61.143 | ||
aromaticity | 0.040 | ||
GRAVY | -0.394 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.277 | ||
sheet | 0.178 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344579.1 | 5prime_partial | 103 | 615-304(-) |
Amino Acid sequence : | |||
APVPPPPWSSTSSAPSSNPAPSPTSSASPPPSAPRSRPPPSASPSPPSTPTPTSTSPSTAPTRSTPISTSSRAAAAPSSARRWWRRPPISLLSSSTTLNWYWG* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,074.303 | ||
Theoretical pI: | 6.513 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 61.143 | ||
aromaticity | 0.040 | ||
GRAVY | -0.394 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.277 | ||
sheet | 0.178 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344579.1 | 5prime_partial | 101 | 2-307(+) |
Amino Acid sequence : | |||
DGDSTPTGNNNRGGHTQEQAVLHHPFQGGDLLPGGGGILDRSLEVQIHNVVRVIRHVRLPVAVQSQLGVAPFFLEQILQPDQIIVPAELHHFHRHRQPGPT* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,074.303 | ||
Theoretical pI: | 6.513 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 61.143 | ||
aromaticity | 0.040 | ||
GRAVY | -0.394 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.277 | ||
sheet | 0.178 |