| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344580.1 | internal | 121 | 2-364(+) |
Amino Acid sequence : | |||
| VYVSLTSASPLPSIDPLKGNQKFGASSQATFFGRNFIKAKSFTRTSMTVAVEVSRFNEVTMAPPDPILGVSEAFRADTNELKLNLGVGAYRTEDLQPYVLHVVKKAQNLMLERGKKQKEP P | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 13,675.690 | ||
| Theoretical pI: | 10.890 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 250 | ||
| Instability index: | 57.352 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.593 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.282 | ||
| sheet | 0.171 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344580.1 | 5prime_partial | 117 | 364-11(-) |
Amino Acid sequence : | |||
| GRFFLFFPPFKHKILGFLDNMEHIGLEIFSSIGTNTKVKLQFVRICSECFRNPKNGVRRSHRHFIESRNFNSNGHARPSERLSLDKISPKKCRLTRSSELLISLERIDGRQRGSRCK* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,675.690 | ||
| Theoretical pI: | 10.890 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 250 | ||
| Instability index: | 57.352 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.593 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.282 | ||
| sheet | 0.171 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344580.1 | internal | 121 | 2-364(+) |
Amino Acid sequence : | |||
| VYVSLTSASPLPSIDPLKGNQKFGASSQATFFGRNFIKAKSFTRTSMTVAVEVSRFNEVTMAPPDPILGVSEAFRADTNELKLNLGVGAYRTEDLQPYVLHVVKKAQNLMLERGKKQKEP P | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 13,675.690 | ||
| Theoretical pI: | 10.890 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 250 | ||
| Instability index: | 57.352 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.593 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.282 | ||
| sheet | 0.171 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344580.1 | 5prime_partial | 117 | 364-11(-) |
Amino Acid sequence : | |||
| GRFFLFFPPFKHKILGFLDNMEHIGLEIFSSIGTNTKVKLQFVRICSECFRNPKNGVRRSHRHFIESRNFNSNGHARPSERLSLDKISPKKCRLTRSSELLISLERIDGRQRGSRCK* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,675.690 | ||
| Theoretical pI: | 10.890 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 250 | ||
| Instability index: | 57.352 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.593 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.282 | ||
| sheet | 0.171 | ||