Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344586.1 | 5prime_partial | 170 | 2-514(+) |
Amino Acid sequence : | |||
KMQISLKTLTGKTITLEVESSDTIDNVKANIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGTWRIPFVANHLVKKISQLNLVSKKDLIKTWSRASTIIPEMVGH RIAVYDGRKHVPFRISENMVGHKLGELKPRRQHRKEVHARSKASKNTKKK* | |||
Physicochemical properties | |||
Number of amino acids: | 170 | ||
Molecular weight: | 19,417.365 | ||
Theoretical pI: | 10.335 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 32.883 | ||
aromaticity | 0.041 | ||
GRAVY | -0.652 | ||
Secondary Structure Fraction | |||
Helix | 0.282 | ||
turn | 0.200 | ||
sheet | 0.212 |