| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344592.1 | 3prime_partial | 222 | 47-712(+) |
Amino Acid sequence : | |||
| MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVAADLRASIWKQMSDAGIKYIPSNTFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI VPELGPDVKFSYSSHKAVHEYKEAKALGVDTVPVLVGPVTYLLLSKPAKGVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQWDAF | |||
Physicochemical properties | |||
| Number of amino acids: | 222 | ||
| Molecular weight: | 24,874.245 | ||
| Theoretical pI: | 5.422 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50880 50880 | ||
| Instability index: | 27.050 | ||
| aromaticity | 0.131 | ||
| GRAVY | -0.102 | ||
Secondary Structure Fraction | |||
| Helix | 0.342 | ||
| turn | 0.225 | ||
| sheet | 0.284 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344592.1 | 3prime_partial | 222 | 47-712(+) |
Amino Acid sequence : | |||
| MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVAADLRASIWKQMSDAGIKYIPSNTFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI VPELGPDVKFSYSSHKAVHEYKEAKALGVDTVPVLVGPVTYLLLSKPAKGVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQWDAF | |||
Physicochemical properties | |||
| Number of amino acids: | 222 | ||
| Molecular weight: | 24,874.245 | ||
| Theoretical pI: | 5.422 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50880 50880 | ||
| Instability index: | 27.050 | ||
| aromaticity | 0.131 | ||
| GRAVY | -0.102 | ||
Secondary Structure Fraction | |||
| Helix | 0.342 | ||
| turn | 0.225 | ||
| sheet | 0.284 | ||