| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344604.1 | 5prime_partial | 228 | 3-689(+) |
Amino Acid sequence : | |||
| FTLSYHRNLSHRSFKVPKWLEYFFAYCGVLALQGSPIDWVSTHRYHHQFCDTEKDPHSPIEGFWFSHMSWLFDTKAIAERCGEPNNVGDLEKQPFYKFLQKTYIAHPIALGALLYAIGGL PYIIWGMGVRIVWVYHITWLVNSACHVWGKQAWNTGDLSRNNWWVAMLAFGEGWHNNHHAFEYSARHGLEWWQIDMTWYAIRVLEALGLATDVKLPTPAQKQRMTFAK* | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 26,702.254 | ||
| Theoretical pI: | 8.339 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 98890 99140 | ||
| Instability index: | 40.357 | ||
| aromaticity | 0.171 | ||
| GRAVY | -0.206 | ||
Secondary Structure Fraction | |||
| Helix | 0.364 | ||
| turn | 0.202 | ||
| sheet | 0.237 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344604.1 | 5prime_partial | 228 | 3-689(+) |
Amino Acid sequence : | |||
| FTLSYHRNLSHRSFKVPKWLEYFFAYCGVLALQGSPIDWVSTHRYHHQFCDTEKDPHSPIEGFWFSHMSWLFDTKAIAERCGEPNNVGDLEKQPFYKFLQKTYIAHPIALGALLYAIGGL PYIIWGMGVRIVWVYHITWLVNSACHVWGKQAWNTGDLSRNNWWVAMLAFGEGWHNNHHAFEYSARHGLEWWQIDMTWYAIRVLEALGLATDVKLPTPAQKQRMTFAK* | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 26,702.254 | ||
| Theoretical pI: | 8.339 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 98890 99140 | ||
| Instability index: | 40.357 | ||
| aromaticity | 0.171 | ||
| GRAVY | -0.206 | ||
Secondary Structure Fraction | |||
| Helix | 0.364 | ||
| turn | 0.202 | ||
| sheet | 0.237 | ||