| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344605.1 | 5prime_partial | 215 | 724-77(-) |
Amino Acid sequence : | |||
| FKVPKWLEYFFAYCGVLALQGSPIDWVSTHRYHHQFCDTEKDPHSPIEGFWFSHMSWLFDTKAIAERCGEPNNVGDLEKQPFYKFLQKTYIAHPIALGALLYAIGGLPYIIWGMGVRIVW VYHITWLVNSACHVWGKQAWNTGDLSRNNWWVAMLAFGEGWHNNHHAFEYSARHGLEWWQIDMTWYAIRVLEAFGLATDVKLPTPAQKQRMTFAK* | |||
Physicochemical properties | |||
| Number of amino acids: | 215 | ||
| Molecular weight: | 25,136.520 | ||
| Theoretical pI: | 7.329 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 97400 97650 | ||
| Instability index: | 39.001 | ||
| aromaticity | 0.177 | ||
| GRAVY | -0.163 | ||
Secondary Structure Fraction | |||
| Helix | 0.367 | ||
| turn | 0.195 | ||
| sheet | 0.237 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344605.1 | 5prime_partial | 215 | 724-77(-) |
Amino Acid sequence : | |||
| FKVPKWLEYFFAYCGVLALQGSPIDWVSTHRYHHQFCDTEKDPHSPIEGFWFSHMSWLFDTKAIAERCGEPNNVGDLEKQPFYKFLQKTYIAHPIALGALLYAIGGLPYIIWGMGVRIVW VYHITWLVNSACHVWGKQAWNTGDLSRNNWWVAMLAFGEGWHNNHHAFEYSARHGLEWWQIDMTWYAIRVLEAFGLATDVKLPTPAQKQRMTFAK* | |||
Physicochemical properties | |||
| Number of amino acids: | 215 | ||
| Molecular weight: | 25,136.520 | ||
| Theoretical pI: | 7.329 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 97400 97650 | ||
| Instability index: | 39.001 | ||
| aromaticity | 0.177 | ||
| GRAVY | -0.163 | ||
Secondary Structure Fraction | |||
| Helix | 0.367 | ||
| turn | 0.195 | ||
| sheet | 0.237 | ||