Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344607.1 | complete | 126 | 260-640(+) |
Amino Acid sequence : | |||
MGATLLDGVVVEKHAMVAAGSLVRQDTRIPSGEVWAGNPAKFLRKLTEEEIAFIIQSAANYINLSKVHAAENAKSFDEIELEKMLRKKFARRDEEYDSMIGVVRETPPELVLPDNILPQK SQKAVQ* | |||
Physicochemical properties | |||
Number of amino acids: | 126 | ||
Molecular weight: | 14,047.999 | ||
Theoretical pI: | 5.732 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 57.238 | ||
aromaticity | 0.056 | ||
GRAVY | -0.272 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.190 | ||
sheet | 0.333 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344607.1 | complete | 126 | 260-640(+) |
Amino Acid sequence : | |||
MGATLLDGVVVEKHAMVAAGSLVRQDTRIPSGEVWAGNPAKFLRKLTEEEIAFIIQSAANYINLSKVHAAENAKSFDEIELEKMLRKKFARRDEEYDSMIGVVRETPPELVLPDNILPQK SQKAVQ* | |||
Physicochemical properties | |||
Number of amino acids: | 126 | ||
Molecular weight: | 14,047.999 | ||
Theoretical pI: | 5.732 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 57.238 | ||
aromaticity | 0.056 | ||
GRAVY | -0.272 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.190 | ||
sheet | 0.333 |