| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344615.1 | internal | 228 | 1-684(+) |
Amino Acid sequence : | |||
| PISPPPAELWIPSHDGATLLSPASTPTSTTSSRRRNAASAAGSSSSPPRTSPTFAVIEALGSALTNRYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLNPTRWGVNVQPYSGSPANF AAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESFPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYPRDWDYKRFRQVADKCGALLLCDMAHI | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 13,611.501 | ||
| Theoretical pI: | 11.424 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 91.008 | ||
| aromaticity | 0.034 | ||
| GRAVY | -1.037 | ||
Secondary Structure Fraction | |||
| Helix | 0.214 | ||
| turn | 0.256 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344615.1 | 5prime_partial | 192 | 2-580(+) |
Amino Acid sequence : | |||
| LYLLRRRNYGSRLTMGQRSSLRRRPRHPRPHREGETPPVPRDRAHRLRELHLPSPSSKPSEARSPTDTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPDGASMSSLTAAPPLIS PPTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRSTSRAFRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 13,611.501 | ||
| Theoretical pI: | 11.424 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 91.008 | ||
| aromaticity | 0.034 | ||
| GRAVY | -1.037 | ||
Secondary Structure Fraction | |||
| Helix | 0.214 | ||
| turn | 0.256 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344615.1 | 5prime_partial | 135 | 684-277(-) |
Amino Acid sequence : | |||
| NMRHIAEQKRPALISNLPKSLVIPVPRISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRKALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDPVVGVENSRVGGEISGGAAVRLDI DAPSGGVEAVGLEGT* | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 13,611.501 | ||
| Theoretical pI: | 11.424 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 91.008 | ||
| aromaticity | 0.034 | ||
| GRAVY | -1.037 | ||
Secondary Structure Fraction | |||
| Helix | 0.214 | ||
| turn | 0.256 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344615.1 | 5prime_partial | 117 | 3-356(+) |
Amino Acid sequence : | |||
| YISSAGGIMDPVSRWGNAPLSGVDPDIHDLIEKEKRRQCRGIELIASENFTYLRRHRSPRKRAHQQILRGHARQPLLRRQRVHRRDREPHSLTCPPGLPPQPHQMGRQCPALQRLPR* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,611.501 | ||
| Theoretical pI: | 11.424 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 91.008 | ||
| aromaticity | 0.034 | ||
| GRAVY | -1.037 | ||
Secondary Structure Fraction | |||
| Helix | 0.214 | ||
| turn | 0.256 | ||
| sheet | 0.205 | ||