| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344628.1 | 5prime_partial | 122 | 3-371(+) |
Amino Acid sequence : | |||
| TLFEFQTMPCLNISTTFSLEAVDTSAILSEISSTVAKLVDKPEDYVMVVLKGSVPISFGGTEQPAAYGELVSMGGLNPDVNKKISGAIASILETKLSVPKSRYFLKFYDTKGSNFGWNGS TF* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,142.877 | ||
| Theoretical pI: | 5.016 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 34.898 | ||
| aromaticity | 0.107 | ||
| GRAVY | 0.112 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.295 | ||
| sheet | 0.230 | ||