Acc_NO	ORF type	length	start-end position (strand +/-)
>DY344631.1	5prime_partial	153	2-463(+)
Amino Acid sequence :
HAVYLQAVIKETLRLPLAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAQWKKPEEFRPERFLEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLP PPGQSKIDTTEKGGQFSLHILKHSTIVLKPRSV*
Physicochemical properties
Number of amino acids:		153
Molecular weight:		13,726.682
Theoretical pI:		5.662
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12615
Instability index:		41.584
aromaticity		0.049
GRAVY		-0.185
Secondary Structure Fraction
Helix		0.328
turn		0.189
sheet		0.320

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY344631.1	complete	122	430-62(-)
Amino Acid sequence :
MLQNVKTELATFLRRIDLRLPWWRQQLEVLYESAQRNTQNRQCKDNTRAAPSADAEGEVPKVIAIGLDFSLLLQESLGPELLGLFPLGRVVGKPPRIHQDLALGRDVVATELCIMEVHVG DQ*
Physicochemical properties
Number of amino acids:		122
Molecular weight:		13,726.682
Theoretical pI:		5.662
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12615
Instability index:		41.584
aromaticity		0.049
GRAVY		-0.185
Secondary Structure Fraction
Helix		0.328
turn		0.189
sheet		0.320