| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344634.1 | internal | 256 | 3-770(+) |
Amino Acid sequence : | |||
| TRFNAGSTIWTDGSLPVHTLSTISQQRFSLGNEKLDFSSENDTSSKILERMTSVLEEMQAPSTSNSAFGPCLLQQEEENVGQFLYLEGIEYHMWNTYDVHFYSSFALLMLFPKLELSIQR DFAMAVMMNDPRRMKIMSDGTWVPKKVLGAVPHDIGLNDPWFEVNAYNLFNTDSWKDLNSKFVLQVYRDVVATGDKSFAKAVWPAVFTAIAFMDQFDKDRDGMIENEGFPDMTYDAWTVT GVSSYCGGLWTAALQA | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 10,660.315 | ||
| Theoretical pI: | 5.706 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
| Instability index: | 37.128 | ||
| aromaticity | 0.061 | ||
| GRAVY | 0.356 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.303 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344634.1 | complete | 100 | 312-10(-) |
Amino Acid sequence : | |||
| MSRSGHRMCSTCGIRSLQGIRTGPHSLLLAVVDKVQKLSLMLMELAFLQEPMSSFQEFYSRCHFQMRNPVSRCQVKTSAVKWWRVYGQEEIHLSILCFLH* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 10,660.315 | ||
| Theoretical pI: | 5.706 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
| Instability index: | 37.128 | ||
| aromaticity | 0.061 | ||
| GRAVY | 0.356 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.303 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344634.1 | 5prime_partial | 99 | 770-471(-) |
Amino Acid sequence : | |||
| GLKGCSPQPPAIRAHPCHCPCIVGHVGEPLILDHPISILIELVHEGYGCENCGPNSLSKALITGSYNISVHLKNEFGVQIFPAVCVEEIVGIHFEPWIV* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 10,660.315 | ||
| Theoretical pI: | 5.706 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
| Instability index: | 37.128 | ||
| aromaticity | 0.061 | ||
| GRAVY | 0.356 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.303 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344634.1 | internal | 256 | 3-770(+) |
Amino Acid sequence : | |||
| TRFNAGSTIWTDGSLPVHTLSTISQQRFSLGNEKLDFSSENDTSSKILERMTSVLEEMQAPSTSNSAFGPCLLQQEEENVGQFLYLEGIEYHMWNTYDVHFYSSFALLMLFPKLELSIQR DFAMAVMMNDPRRMKIMSDGTWVPKKVLGAVPHDIGLNDPWFEVNAYNLFNTDSWKDLNSKFVLQVYRDVVATGDKSFAKAVWPAVFTAIAFMDQFDKDRDGMIENEGFPDMTYDAWTVT GVSSYCGGLWTAALQA | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 10,660.315 | ||
| Theoretical pI: | 5.706 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
| Instability index: | 37.128 | ||
| aromaticity | 0.061 | ||
| GRAVY | 0.356 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.303 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344634.1 | complete | 100 | 312-10(-) |
Amino Acid sequence : | |||
| MSRSGHRMCSTCGIRSLQGIRTGPHSLLLAVVDKVQKLSLMLMELAFLQEPMSSFQEFYSRCHFQMRNPVSRCQVKTSAVKWWRVYGQEEIHLSILCFLH* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 10,660.315 | ||
| Theoretical pI: | 5.706 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
| Instability index: | 37.128 | ||
| aromaticity | 0.061 | ||
| GRAVY | 0.356 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.303 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344634.1 | 5prime_partial | 99 | 770-471(-) |
Amino Acid sequence : | |||
| GLKGCSPQPPAIRAHPCHCPCIVGHVGEPLILDHPISILIELVHEGYGCENCGPNSLSKALITGSYNISVHLKNEFGVQIFPAVCVEEIVGIHFEPWIV* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 10,660.315 | ||
| Theoretical pI: | 5.706 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
| Instability index: | 37.128 | ||
| aromaticity | 0.061 | ||
| GRAVY | 0.356 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.303 | ||
| sheet | 0.202 | ||