Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344634.1 | internal | 256 | 3-770(+) |
Amino Acid sequence : | |||
TRFNAGSTIWTDGSLPVHTLSTISQQRFSLGNEKLDFSSENDTSSKILERMTSVLEEMQAPSTSNSAFGPCLLQQEEENVGQFLYLEGIEYHMWNTYDVHFYSSFALLMLFPKLELSIQR DFAMAVMMNDPRRMKIMSDGTWVPKKVLGAVPHDIGLNDPWFEVNAYNLFNTDSWKDLNSKFVLQVYRDVVATGDKSFAKAVWPAVFTAIAFMDQFDKDRDGMIENEGFPDMTYDAWTVT GVSSYCGGLWTAALQA | |||
Physicochemical properties | |||
Number of amino acids: | 256 | ||
Molecular weight: | 10,660.315 | ||
Theoretical pI: | 5.706 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
Instability index: | 37.128 | ||
aromaticity | 0.061 | ||
GRAVY | 0.356 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.303 | ||
sheet | 0.202 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344634.1 | complete | 100 | 312-10(-) |
Amino Acid sequence : | |||
MSRSGHRMCSTCGIRSLQGIRTGPHSLLLAVVDKVQKLSLMLMELAFLQEPMSSFQEFYSRCHFQMRNPVSRCQVKTSAVKWWRVYGQEEIHLSILCFLH* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 10,660.315 | ||
Theoretical pI: | 5.706 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
Instability index: | 37.128 | ||
aromaticity | 0.061 | ||
GRAVY | 0.356 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.303 | ||
sheet | 0.202 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344634.1 | 5prime_partial | 99 | 770-471(-) |
Amino Acid sequence : | |||
GLKGCSPQPPAIRAHPCHCPCIVGHVGEPLILDHPISILIELVHEGYGCENCGPNSLSKALITGSYNISVHLKNEFGVQIFPAVCVEEIVGIHFEPWIV* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 10,660.315 | ||
Theoretical pI: | 5.706 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
Instability index: | 37.128 | ||
aromaticity | 0.061 | ||
GRAVY | 0.356 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.303 | ||
sheet | 0.202 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344634.1 | internal | 256 | 3-770(+) |
Amino Acid sequence : | |||
TRFNAGSTIWTDGSLPVHTLSTISQQRFSLGNEKLDFSSENDTSSKILERMTSVLEEMQAPSTSNSAFGPCLLQQEEENVGQFLYLEGIEYHMWNTYDVHFYSSFALLMLFPKLELSIQR DFAMAVMMNDPRRMKIMSDGTWVPKKVLGAVPHDIGLNDPWFEVNAYNLFNTDSWKDLNSKFVLQVYRDVVATGDKSFAKAVWPAVFTAIAFMDQFDKDRDGMIENEGFPDMTYDAWTVT GVSSYCGGLWTAALQA | |||
Physicochemical properties | |||
Number of amino acids: | 256 | ||
Molecular weight: | 10,660.315 | ||
Theoretical pI: | 5.706 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
Instability index: | 37.128 | ||
aromaticity | 0.061 | ||
GRAVY | 0.356 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.303 | ||
sheet | 0.202 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344634.1 | complete | 100 | 312-10(-) |
Amino Acid sequence : | |||
MSRSGHRMCSTCGIRSLQGIRTGPHSLLLAVVDKVQKLSLMLMELAFLQEPMSSFQEFYSRCHFQMRNPVSRCQVKTSAVKWWRVYGQEEIHLSILCFLH* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 10,660.315 | ||
Theoretical pI: | 5.706 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
Instability index: | 37.128 | ||
aromaticity | 0.061 | ||
GRAVY | 0.356 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.303 | ||
sheet | 0.202 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344634.1 | 5prime_partial | 99 | 770-471(-) |
Amino Acid sequence : | |||
GLKGCSPQPPAIRAHPCHCPCIVGHVGEPLILDHPISILIELVHEGYGCENCGPNSLSKALITGSYNISVHLKNEFGVQIFPAVCVEEIVGIHFEPWIV* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 10,660.315 | ||
Theoretical pI: | 5.706 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
Instability index: | 37.128 | ||
aromaticity | 0.061 | ||
GRAVY | 0.356 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.303 | ||
sheet | 0.202 |