| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344642.1 | complete | 103 | 34-345(+) |
Amino Acid sequence : | |||
| MVLLTLKNVEVVDTTCPWVSKVWHAVEKHTKGDYTSIIHGKYAHEETVATASFAGNYIVVENITEATYVCDYILGGGLDGSSSTKEAFLKKFKSAVSKGFDPD* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,260.616 | ||
| Theoretical pI: | 5.742 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
| Instability index: | 21.749 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.075 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.204 | ||
| sheet | 0.214 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344642.1 | complete | 103 | 34-345(+) |
Amino Acid sequence : | |||
| MVLLTLKNVEVVDTTCPWVSKVWHAVEKHTKGDYTSIIHGKYAHEETVATASFAGNYIVVENITEATYVCDYILGGGLDGSSSTKEAFLKKFKSAVSKGFDPD* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,260.616 | ||
| Theoretical pI: | 5.742 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
| Instability index: | 21.749 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.075 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.204 | ||
| sheet | 0.214 | ||