| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EB741004.1 | internal | 122 | 367-2(-) |
Amino Acid sequence : | |||
| TKPADKDSLKCAIDHMIEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPHIQKKLRDELDTVLGPGVQITEPDTHKLPYLQAVIKETLSSPYGDPTARAPHEPPRRQAR RV | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,736.410 | ||
| Theoretical pI: | 5.478 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 55.361 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.559 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.197 | ||
| sheet | 0.262 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EB741004.1 | internal | 122 | 367-2(-) |
Amino Acid sequence : | |||
| TKPADKDSLKCAIDHMIEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPHIQKKLRDELDTVLGPGVQITEPDTHKLPYLQAVIKETLSSPYGDPTARAPHEPPRRQAR RV | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,736.410 | ||
| Theoretical pI: | 5.478 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 55.361 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.559 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.197 | ||
| sheet | 0.262 | ||