| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EB741006.1 | internal | 134 | 1-402(+) |
Amino Acid sequence : | |||
| QSXQGCLAESDSELQAWWTEIKTVGHGDKKDEPWWPELKTPNDLIGILTTIIWIASDHHSAVNFGQFDYGAYFPNRPTTARVPMPTEEPSDEEKREFLERPEAFLMKSFPSQLQATVIMT ILDVLSNHSPDEEY | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 15,222.762 | ||
| Theoretical pI: | 4.494 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 31970 | ||
| Instability index: | 57.405 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.592 | ||
Secondary Structure Fraction | |||
| Helix | 0.278 | ||
| turn | 0.233 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EB741006.1 | internal | 134 | 1-402(+) |
Amino Acid sequence : | |||
| QSXQGCLAESDSELQAWWTEIKTVGHGDKKDEPWWPELKTPNDLIGILTTIIWIASDHHSAVNFGQFDYGAYFPNRPTTARVPMPTEEPSDEEKREFLERPEAFLMKSFPSQLQATVIMT ILDVLSNHSPDEEY | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 15,222.762 | ||
| Theoretical pI: | 4.494 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 31970 | ||
| Instability index: | 57.405 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.592 | ||
Secondary Structure Fraction | |||
| Helix | 0.278 | ||
| turn | 0.233 | ||
| sheet | 0.263 | ||