| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EB741008.1 | internal | 196 | 1-588(+) |
Amino Acid sequence : | |||
| KLWRFDLEALPADLIHRGMAVEDPTSPHGLKLTIEDYPYANDGLLLWDAIKQWVTDYVSCYYPESEPGLVESDSELQAWWTEIKTVGHGDKKDEPWWPELKTPNDLIGILTTIIWIASGH HSAVNFGQFDYGAYFPNRPTTARVPMPTEEPSDEEKREFLERPEAFLMKSFPSQLQATVIMTILDVLSNHSPGRRV | |||
Physicochemical properties | |||
| Number of amino acids: | 196 | ||
| Molecular weight: | 22,428.017 | ||
| Theoretical pI: | 4.731 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 54430 54430 | ||
| Instability index: | 58.130 | ||
| aromaticity | 0.112 | ||
| GRAVY | -0.436 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.230 | ||
| sheet | 0.265 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EB741008.1 | internal | 196 | 1-588(+) |
Amino Acid sequence : | |||
| KLWRFDLEALPADLIHRGMAVEDPTSPHGLKLTIEDYPYANDGLLLWDAIKQWVTDYVSCYYPESEPGLVESDSELQAWWTEIKTVGHGDKKDEPWWPELKTPNDLIGILTTIIWIASGH HSAVNFGQFDYGAYFPNRPTTARVPMPTEEPSDEEKREFLERPEAFLMKSFPSQLQATVIMTILDVLSNHSPGRRV | |||
Physicochemical properties | |||
| Number of amino acids: | 196 | ||
| Molecular weight: | 22,428.017 | ||
| Theoretical pI: | 4.731 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 54430 54430 | ||
| Instability index: | 58.130 | ||
| aromaticity | 0.112 | ||
| GRAVY | -0.436 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.230 | ||
| sheet | 0.265 | ||