| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EB741009.1 | internal | 119 | 358-2(-) |
Amino Acid sequence : | |||
| YGSRTLFFLMPGGTLRPLAIELTRPPMDGKPQWKGVFDPCWDPTGIWLWRLAKTHVLAHDSGYHQLISHWLRTHCCTEPYIIATHRQLSAMHPIHRLLHPHLRYTMEINAQARQALINA | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,824.959 | ||
| Theoretical pI: | 9.505 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33585 | ||
| Instability index: | 48.033 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.253 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.193 | ||
| sheet | 0.261 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EB741009.1 | internal | 119 | 358-2(-) |
Amino Acid sequence : | |||
| YGSRTLFFLMPGGTLRPLAIELTRPPMDGKPQWKGVFDPCWDPTGIWLWRLAKTHVLAHDSGYHQLISHWLRTHCCTEPYIIATHRQLSAMHPIHRLLHPHLRYTMEINAQARQALINA | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,824.959 | ||
| Theoretical pI: | 9.505 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33585 | ||
| Instability index: | 48.033 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.253 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.193 | ||
| sheet | 0.261 | ||