| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EB741015.1 | 3prime_partial | 122 | 25-390(+) |
Amino Acid sequence : | |||
| MPGGTLRPLAIELTRPPMDGKPQWKGVFDPCWDPTGIWLWRLAKTHVLAHDSGYHQLISHWLRTHCCTEPYIIATHRQLSAMHPIHRLLHPHLRYTMEINAQARQALINADGIIETGFSP GK | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,942.018 | ||
| Theoretical pI: | 8.959 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 32095 | ||
| Instability index: | 50.634 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.320 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.213 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EB741015.1 | 3prime_partial | 122 | 25-390(+) |
Amino Acid sequence : | |||
| MPGGTLRPLAIELTRPPMDGKPQWKGVFDPCWDPTGIWLWRLAKTHVLAHDSGYHQLISHWLRTHCCTEPYIIATHRQLSAMHPIHRLLHPHLRYTMEINAQARQALINADGIIETGFSP GK | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,942.018 | ||
| Theoretical pI: | 8.959 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 32095 | ||
| Instability index: | 50.634 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.320 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.213 | ||
| sheet | 0.246 | ||