| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EB741020.1 | internal | 130 | 2-391(+) |
Amino Acid sequence : | |||
| GSSMDFFNAWGNLRPLAIELTRPPMDGKPQWKGVFDPCWDPTGIWLWRLAKTHVLAHDSGHHQLISHWLRTHCCTEPYIIATHRQLSAMHPIHRLLHPHLRYTMEINAQARQALINAEGI IETGFSPGKY | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 14,964.047 | ||
| Theoretical pI: | 8.589 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37470 37595 | ||
| Instability index: | 44.265 | ||
| aromaticity | 0.100 | ||
| GRAVY | -0.350 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.223 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EB741020.1 | internal | 130 | 2-391(+) |
Amino Acid sequence : | |||
| GSSMDFFNAWGNLRPLAIELTRPPMDGKPQWKGVFDPCWDPTGIWLWRLAKTHVLAHDSGHHQLISHWLRTHCCTEPYIIATHRQLSAMHPIHRLLHPHLRYTMEINAQARQALINAEGI IETGFSPGKY | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 14,964.047 | ||
| Theoretical pI: | 8.589 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37470 37595 | ||
| Instability index: | 44.265 | ||
| aromaticity | 0.100 | ||
| GRAVY | -0.350 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.223 | ||
| sheet | 0.246 | ||