| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EB741021.1 | internal | 132 | 397-2(-) |
Amino Acid sequence : | |||
| YGSRTLFFLMPGGTLRPLAIELTRPPMDGKPQWKGVFDPCWDPTGIWLWRLAKTHVLAHDSGYHQLISHWLRTHCCTEPYIIATHRQLSAMHPIHRLLHPHLRYTMEINAQARQALINAE GIHXKLVLGTAM | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 15,075.469 | ||
| Theoretical pI: | 9.454 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33585 | ||
| Instability index: | 45.354 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.169 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.191 | ||
| sheet | 0.275 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EB741021.1 | internal | 132 | 397-2(-) |
Amino Acid sequence : | |||
| YGSRTLFFLMPGGTLRPLAIELTRPPMDGKPQWKGVFDPCWDPTGIWLWRLAKTHVLAHDSGYHQLISHWLRTHCCTEPYIIATHRQLSAMHPIHRLLHPHLRYTMEINAQARQALINAE GIHXKLVLGTAM | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 15,075.469 | ||
| Theoretical pI: | 9.454 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33585 | ||
| Instability index: | 45.354 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.169 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.191 | ||
| sheet | 0.275 | ||