| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EB741022.1 | internal | 137 | 411-1(-) |
Amino Acid sequence : | |||
| YYYPESEPGLVESDSELQAWWTEIKTVGHGDKKDEPWWPELKTPNDLIGILTTIIWIASGHHSAVNFGQFDYGAYFPNRPTTARVPMPTEEPSEEEKREFLERPEAFLMKSFPSQLQATV IMTILDVSVKDTPPNED | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 15,700.331 | ||
| Theoretical pI: | 4.505 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 34950 | ||
| Instability index: | 58.443 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.608 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.248 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EB741022.1 | internal | 137 | 411-1(-) |
Amino Acid sequence : | |||
| YYYPESEPGLVESDSELQAWWTEIKTVGHGDKKDEPWWPELKTPNDLIGILTTIIWIASGHHSAVNFGQFDYGAYFPNRPTTARVPMPTEEPSEEEKREFLERPEAFLMKSFPSQLQATV IMTILDVSVKDTPPNED | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 15,700.331 | ||
| Theoretical pI: | 4.505 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 34950 | ||
| Instability index: | 58.443 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.608 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.248 | ||
| sheet | 0.255 | ||