| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EB741023.1 | internal | 135 | 3-407(+) |
Amino Acid sequence : | |||
| YSESDPGLVESDSELQAWWTEIKTVGHGDKKDEPWWPELKTPNDLIGILTTIIWIASGHHSAVNFGQFDYGAYFPNRPTTARVPMPTEEPSEEEKREFLERPEAFLMKSFPSQLQATVIM TILDVLSNHSPDEEY | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 15,438.972 | ||
| Theoretical pI: | 4.470 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33460 | ||
| Instability index: | 57.289 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.588 | ||
Secondary Structure Fraction | |||
| Helix | 0.289 | ||
| turn | 0.252 | ||
| sheet | 0.267 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EB741023.1 | internal | 135 | 3-407(+) |
Amino Acid sequence : | |||
| YSESDPGLVESDSELQAWWTEIKTVGHGDKKDEPWWPELKTPNDLIGILTTIIWIASGHHSAVNFGQFDYGAYFPNRPTTARVPMPTEEPSEEEKREFLERPEAFLMKSFPSQLQATVIM TILDVLSNHSPDEEY | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 15,438.972 | ||
| Theoretical pI: | 4.470 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33460 | ||
| Instability index: | 57.289 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.588 | ||
Secondary Structure Fraction | |||
| Helix | 0.289 | ||
| turn | 0.252 | ||
| sheet | 0.267 | ||