| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EB741025.1 | internal | 205 | 2-616(+) |
Amino Acid sequence : | |||
| GSSRFISQGKLWRFDLEALPADLIHRGMAVEDPTSPHGLKLTIEDYPYANDGLLLWDAIKQWVTDYVSYYYPESEPGLVESDSELQAWWTEIKTVGHGDKKDEPWWPELKTPNDLIGILT TIIWIASGHHSAVNFGQFDYGAYFPNRPTTARVPMPTEEPSDEEKREFLERPEAFLMKSFPSQLQATVIMTILDVLSNHSPDEEY | |||
Physicochemical properties | |||
| Number of amino acids: | 205 | ||
| Molecular weight: | 23,475.963 | ||
| Theoretical pI: | 4.544 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 57410 57410 | ||
| Instability index: | 55.861 | ||
| aromaticity | 0.122 | ||
| GRAVY | -0.486 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.239 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EB741025.1 | internal | 205 | 2-616(+) |
Amino Acid sequence : | |||
| GSSRFISQGKLWRFDLEALPADLIHRGMAVEDPTSPHGLKLTIEDYPYANDGLLLWDAIKQWVTDYVSYYYPESEPGLVESDSELQAWWTEIKTVGHGDKKDEPWWPELKTPNDLIGILT TIIWIASGHHSAVNFGQFDYGAYFPNRPTTARVPMPTEEPSDEEKREFLERPEAFLMKSFPSQLQATVIMTILDVLSNHSPDEEY | |||
Physicochemical properties | |||
| Number of amino acids: | 205 | ||
| Molecular weight: | 23,475.963 | ||
| Theoretical pI: | 4.544 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 57410 57410 | ||
| Instability index: | 55.861 | ||
| aromaticity | 0.122 | ||
| GRAVY | -0.486 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.239 | ||
| sheet | 0.263 | ||