| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EB741026.1 | internal | 107 | 3-323(+) |
Amino Acid sequence : | |||
| SWIFDVEETLLXNKLYLNSSEFQYGAKAVNMTTYYEYLKRSPAEEVAAVFELYQQVFSWGYKIFLISGAHESFRNDLVELLEYPGYDYYVKLILKGDKDNGKSVGQY | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,410.805 | ||
| Theoretical pI: | 4.774 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 28880 | ||
| Instability index: | 30.814 | ||
| aromaticity | 0.189 | ||
| GRAVY | -0.308 | ||
Secondary Structure Fraction | |||
| Helix | 0.415 | ||
| turn | 0.208 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EB741026.1 | internal | 107 | 3-323(+) |
Amino Acid sequence : | |||
| SWIFDVEETLLXNKLYLNSSEFQYGAKAVNMTTYYEYLKRSPAEEVAAVFELYQQVFSWGYKIFLISGAHESFRNDLVELLEYPGYDYYVKLILKGDKDNGKSVGQY | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,410.805 | ||
| Theoretical pI: | 4.774 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 28880 | ||
| Instability index: | 30.814 | ||
| aromaticity | 0.189 | ||
| GRAVY | -0.308 | ||
Secondary Structure Fraction | |||
| Helix | 0.415 | ||
| turn | 0.208 | ||
| sheet | 0.274 | ||