| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EB741027.1 | internal | 134 | 3-404(+) |
Amino Acid sequence : | |||
| FEAEPGLVESDSELQAWWTEIKTVGHGDKKDEPWWPELKTPNDLIGILTTIIWIASGHHSAVNFGQFDYGAYFPNRPTTARVPMPTEEPSEEEKREFLERPEAFLMKSFPSQLQATVIMT ILDVLSNHSPDEEY | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 15,333.922 | ||
| Theoretical pI: | 4.486 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 31970 | ||
| Instability index: | 56.204 | ||
| aromaticity | 0.112 | ||
| GRAVY | -0.537 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.239 | ||
| sheet | 0.284 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EB741027.1 | internal | 134 | 3-404(+) |
Amino Acid sequence : | |||
| FEAEPGLVESDSELQAWWTEIKTVGHGDKKDEPWWPELKTPNDLIGILTTIIWIASGHHSAVNFGQFDYGAYFPNRPTTARVPMPTEEPSEEEKREFLERPEAFLMKSFPSQLQATVIMT ILDVLSNHSPDEEY | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 15,333.922 | ||
| Theoretical pI: | 4.486 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 31970 | ||
| Instability index: | 56.204 | ||
| aromaticity | 0.112 | ||
| GRAVY | -0.537 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.239 | ||
| sheet | 0.284 | ||