| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EB741030.1 | 3prime_partial | 174 | 524-3(-) |
Amino Acid sequence : | |||
| MAVEDPTSPHGLKLTIEDYPYANDGLLLWDAIKQWVTDYVSYYYPESEPGLVESDSELQAWWTEIKTVGHGDKKDEPWWPELKTPNDLIGILTTIIWIASGHHSAVNFGQFDYSAYFPNR PTTARVPMPTEEPSDEEKREFLERPEAFLMKSFPSQLQATVIMTILEFCMQPLD | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 20,031.282 | ||
| Theoretical pI: | 4.411 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50420 50420 | ||
| Instability index: | 57.228 | ||
| aromaticity | 0.126 | ||
| GRAVY | -0.441 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.224 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EB741030.1 | 3prime_partial | 174 | 524-3(-) |
Amino Acid sequence : | |||
| MAVEDPTSPHGLKLTIEDYPYANDGLLLWDAIKQWVTDYVSYYYPESEPGLVESDSELQAWWTEIKTVGHGDKKDEPWWPELKTPNDLIGILTTIIWIASGHHSAVNFGQFDYSAYFPNR PTTARVPMPTEEPSDEEKREFLERPEAFLMKSFPSQLQATVIMTILEFCMQPLD | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 20,031.282 | ||
| Theoretical pI: | 4.411 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50420 50420 | ||
| Instability index: | 57.228 | ||
| aromaticity | 0.126 | ||
| GRAVY | -0.441 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.224 | ||
| sheet | 0.270 | ||