| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EE297456.1 | complete | 133 | 142-543(+) |
Amino Acid sequence : | |||
| MAFFNRVGSLLRQNAVSGGQLSMPSMLNSLRCMSSSKLFIGGLSWGTDDQSLKEAFSSFGDVTEARVIVDRETGRSRGFGFVNFTDEEAAVSAMSAMDGQELNGRNIRVSYATGRSAGPP RNNFRRSNDYEEF* | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 11,279.908 | ||
| Theoretical pI: | 5.327 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 62.907 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.225 | ||
Secondary Structure Fraction | |||
| Helix | 0.245 | ||
| turn | 0.275 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EE297456.1 | complete | 102 | 431-123(-) |
Amino Acid sequence : | |||
| MADMAETAASSSVKLTNPNPLDLPVSLSTITLASVTSPKLEKASFSDWSSVPHERPPMKSLEEDMQRREFNIEGMESCPPDTAFCLRRLPTLLKKAIWCLSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,279.908 | ||
| Theoretical pI: | 5.327 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 62.907 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.225 | ||
Secondary Structure Fraction | |||
| Helix | 0.245 | ||
| turn | 0.275 | ||
| sheet | 0.324 | ||