Acc_NO	ORF type	length	start-end position (strand +/-)
>EE297460.1	5prime_partial	212	1-639(+)
Amino Acid sequence :
TSFRLTLPEVTSFPDFLVEKTRYDAATERNWTARDKCQVWWKNEGEEDGGWWEGRILALKAKAPEFPDSPWERYAIRYKSDPGEIHYHSPWELHDSGTQWEQPHIDAQTTKKLLSSLAKL EHSGNRSEDIYGLQKLREVSQKSSFLNRFPVPLTMDVIRARLENNYYRSVEAVRHDIKVMLSNVESYFVRSAENSAKMKRLSDWFNRALSCL*
Physicochemical properties
Number of amino acids:		212
Molecular weight:		24,886.649
Theoretical pI:		6.972
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		61420 61545
Instability index:		50.379
aromaticity		0.118
GRAVY		-0.773
Secondary Structure Fraction
Helix		0.292
turn		0.222
sheet		0.259