| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EE297464.1 | 5prime_partial | 184 | 1-555(+) |
Amino Acid sequence : | |||
| TEIVEKCLNDANMVKSTVDDIVLVGGSTRIPKVQQLLRDLFDGRDLCQSINPDEAVAYGAATKAANMSGGGNQKVRDLVLCDVTPLSLGCETFGGDFVVLIPRNTSIPCRKETSGSASVD NQTSCRIKIYEGERPRAEDNTLLGEFELSGYPPSXKGDPTXHICFDIXRQWNLECYSHRKYYLE* | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 19,953.287 | ||
| Theoretical pI: | 5.024 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14940 | ||
| Instability index: | 26.586 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.372 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.254 | ||
| sheet | 0.215 | ||