| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EE297469.1 | internal | 219 | 2-658(+) |
Amino Acid sequence : | |||
| HEILMNLKEIVLRSNLYGTRDASICVRGPRCITAHDIILPPGVEIIDNTQHIATLMEPIDLCIGLQLERNRGYRMQTQNNFQDESYPIDTVFMPVRNVNHSIHSYGNGNEKQEILFLEIR TNGSLTPKEALYEASRNLIDLFIPFLHAEEENLHFEANQHKVTLPPFTFHDKLNELRKDKKKIALKSIFIDQLELPPRIXHCLXNSXIHTLLDLLNKSX | |||
Physicochemical properties | |||
| Number of amino acids: | 219 | ||
| Molecular weight: | 24,839.263 | ||
| Theoretical pI: | 6.123 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
| Instability index: | 35.366 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.327 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.219 | ||
| sheet | 0.265 | ||