Acc_NO	ORF type	length	start-end position (strand +/-)
>EE297469.1	internal	219	2-658(+)
Amino Acid sequence :
HEILMNLKEIVLRSNLYGTRDASICVRGPRCITAHDIILPPGVEIIDNTQHIATLMEPIDLCIGLQLERNRGYRMQTQNNFQDESYPIDTVFMPVRNVNHSIHSYGNGNEKQEILFLEIR TNGSLTPKEALYEASRNLIDLFIPFLHAEEENLHFEANQHKVTLPPFTFHDKLNELRKDKKKIALKSIFIDQLELPPRIXHCLXNSXIHTLLDLLNKSX
Physicochemical properties
Number of amino acids:		219
Molecular weight:		24,839.263
Theoretical pI:		6.123
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		7450 7700
Instability index:		35.366
aromaticity		0.065
GRAVY		-0.327
Secondary Structure Fraction
Helix		0.330
turn		0.219
sheet		0.265