| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EE297483.1 | internal | 169 | 508-2(-) |
Amino Acid sequence : | |||
| LLRITYSAHTGLSVKFQSHRSRDYANPYLPVAPSAIDASGQKLEAESNVLLASIENMQYAVTLDVLHTVFSAFGVVQKIAMFDKNGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKL HLSYSRHTDLSIKVNNDRSRDYTIPNPAIVNAQPSLLGQQPGVGPSPTQ | |||
Physicochemical properties | |||
| Number of amino acids: | 169 | ||
| Molecular weight: | 18,369.587 | ||
| Theoretical pI: | 6.639 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12045 | ||
| Instability index: | 38.614 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.130 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.260 | ||
| sheet | 0.237 | ||