Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EE297483.1 | internal | 169 | 508-2(-) |
Amino Acid sequence : | |||
LLRITYSAHTGLSVKFQSHRSRDYANPYLPVAPSAIDASGQKLEAESNVLLASIENMQYAVTLDVLHTVFSAFGVVQKIAMFDKNGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKL HLSYSRHTDLSIKVNNDRSRDYTIPNPAIVNAQPSLLGQQPGVGPSPTQ | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 18,369.587 | ||
Theoretical pI: | 6.639 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12045 | ||
Instability index: | 38.614 | ||
aromaticity | 0.077 | ||
GRAVY | -0.130 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.260 | ||
sheet | 0.237 |