Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EE297489.1 | internal | 176 | 529-2(-) |
Amino Acid sequence : | |||
TDEILREKVLTFIKDKVFPLKSELLKPQEQMERHIADLIKKSLNDVNGAEFKMFVDILSSLSILGDKAPPERVQELLEIIEGQADLYVDFDISDGGDEDHLQRILVCLHMARPFFMKGAS NSKFLNYVNKHLIPVFDKLPEGQKLDLLKGLAESSPYTTPGDSRLILPSIVQLLKK | |||
Physicochemical properties | |||
Number of amino acids: | 176 | ||
Molecular weight: | 19,945.953 | ||
Theoretical pI: | 5.417 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 46.227 | ||
aromaticity | 0.068 | ||
GRAVY | -0.176 | ||
Secondary Structure Fraction | |||
Helix | 0.352 | ||
turn | 0.205 | ||
sheet | 0.290 |