| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EE297489.1 | internal | 176 | 529-2(-) |
Amino Acid sequence : | |||
| TDEILREKVLTFIKDKVFPLKSELLKPQEQMERHIADLIKKSLNDVNGAEFKMFVDILSSLSILGDKAPPERVQELLEIIEGQADLYVDFDISDGGDEDHLQRILVCLHMARPFFMKGAS NSKFLNYVNKHLIPVFDKLPEGQKLDLLKGLAESSPYTTPGDSRLILPSIVQLLKK | |||
Physicochemical properties | |||
| Number of amino acids: | 176 | ||
| Molecular weight: | 19,945.953 | ||
| Theoretical pI: | 5.417 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 46.227 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.176 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.205 | ||
| sheet | 0.290 | ||