| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EE297492.1 | internal | 197 | 592-2(-) |
Amino Acid sequence : | |||
| NHWNERSGXKASLVADDIYEIIMKNASRLDSEIIYDRDFDYDYFGFKTLERSDLLKVEGKVVERPQHMLMRVAVGIHKDDIESAIKTYHLMSQRWFTHASPTLFNAGTPRPQLSSCFLVC MKEDSIEGIYDTLKECAVISKSAGGIGVSAHNIRATGSYIRGTNGTSNGIVPMLRVFNDTARYVDQGGSKRKGAFAV | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 11,647.071 | ||
| Theoretical pI: | 9.855 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 53.887 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.247 | ||
Secondary Structure Fraction | |||
| Helix | 0.262 | ||
| turn | 0.327 | ||
| sheet | 0.159 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EE297492.1 | 5prime_partial | 107 | 2-325(+) |
Amino Acid sequence : | |||
| HRKSSFSLAPSLINIASSIIKDPKHWDNAIGSSICSTNVTACGTNIVRRNTNPSSRFTNHSTLLQSVIYAFYAIFLHTDKEAATQLRPGCSSIKQSWGSMGKPTLGH* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 11,647.071 | ||
| Theoretical pI: | 9.855 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 53.887 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.247 | ||
Secondary Structure Fraction | |||
| Helix | 0.262 | ||
| turn | 0.327 | ||
| sheet | 0.159 | ||