Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EE297498.1 | 5prime_partial | 223 | 3-674(+) |
Amino Acid sequence : | |||
NVTVAEKVVNPPKQAVSVFADTHSSEIRDRIFDEFNSLSVVYQKPSYMFTDKDHRGPFEFADELGNLSIGIESAGTIALAQRVQENDKDLLLSTSEKEENGAHAANGSAYNAPSYDSSSA LVSISDGQSRIPQAQPPSLAIDDLLGLSFTTPPTPTPAPSPSLNLNPKAVLDPGTFQQKWRQLPDSLSQELSLSPLGISALNNTSALLKHMASHSIHCIASGG* | |||
Physicochemical properties | |||
Number of amino acids: | 223 | ||
Molecular weight: | 23,798.138 | ||
Theoretical pI: | 4.921 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 42.215 | ||
aromaticity | 0.058 | ||
GRAVY | -0.322 | ||
Secondary Structure Fraction | |||
Helix | 0.260 | ||
turn | 0.327 | ||
sheet | 0.256 |