Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EE297509.1 | internal | 160 | 1-480(+) |
Amino Acid sequence : | |||
TDMALCPPDLRSIISATNIEDASNNPELLEKMVALLQDGEDFDCPICISPPTRAVITRCAHIFCQGCIVKTLRRSKPSCPMCRHPLTELDLFAAPPERSEINPEGTGGDSNNVLSSRGSA LLKFLNEKRDRKPEAKSVVFSQFRKMLQLLERPLGEAGFK | |||
Physicochemical properties | |||
Number of amino acids: | 160 | ||
Molecular weight: | 17,246.367 | ||
Theoretical pI: | 9.336 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
Instability index: | 50.359 | ||
aromaticity | 0.075 | ||
GRAVY | -0.227 | ||
Secondary Structure Fraction | |||
Helix | 0.250 | ||
turn | 0.350 | ||
sheet | 0.219 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EE297509.1 | internal | 160 | 482-3(-) |
Amino Acid sequence : | |||
TLNPASPRGLSSNCNIFLNCENTTDFASGFRSLFSFRNFNRADPLEDKTLLESPPVPSGLISDRSGGAANRSNSVKGCRHIGQLGLERLRVFTMHPWQKIWAQRVITALVGGEMQMGQSK SSPSCSKATIFSKSSGLFDASSMFVADMIDLKSGGHSAIS | |||
Physicochemical properties | |||
Number of amino acids: | 160 | ||
Molecular weight: | 17,246.367 | ||
Theoretical pI: | 9.336 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
Instability index: | 50.359 | ||
aromaticity | 0.075 | ||
GRAVY | -0.227 | ||
Secondary Structure Fraction | |||
Helix | 0.250 | ||
turn | 0.350 | ||
sheet | 0.219 |