Acc_NO	ORF type	length	start-end position (strand +/-)
>EE297518.1	5prime_partial	201	3-608(+)
Amino Acid sequence :
TVCRQGTPHLDEALGVKSGDNHTNTLVVSEFIGCSPSLSGAIRVNPWDVDAVVEALNMALTMPTAEKQLRHEKHYRYVSSHDVAYWTRSFVQDLERACKDHYNKRCWGFGLGLSFRVVAL SPSFRKLSVEPIVSSYRRSNRRVIFLDYDGTLVQQSSIINAPNSEVISVLNSLCSDPKNTVFIVSGRGRSSLSEWLSHVRG*
Physicochemical properties
Number of amino acids:		201
Molecular weight:		22,470.182
Theoretical pI:		8.866
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		30940 31190
Instability index:		49.293
aromaticity		0.085
GRAVY		-0.229
Secondary Structure Fraction
Helix		0.323
turn		0.279
sheet		0.194