| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EE297525.1 | 5prime_partial | 179 | 576-37(-) |
Amino Acid sequence : | |||
| IFPTKSDGVERPAPAAQEHSETKACVTDETSVVPSMPNQAYQAFKMIAENAVAQQVVASIASDPNVWEAVLRNKALLEHCQQGKICVEYEQAMDMNSCKDSSSVDSTDPADAVPEGVFDK VKVAIMEMVNNCSSFIRDLFGGQDEKSTAEGTGAGPMQVAGTFVGLATIVILVIVLKRS* | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 19,098.452 | ||
| Theoretical pI: | 4.584 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 37.746 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.064 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.229 | ||
| sheet | 0.268 | ||