Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EE297535.1 | 5prime_partial | 178 | 3-539(+) |
Amino Acid sequence : | |||
KGGGLGKNEQGIVAPIEAKLRPKKMGMGFNDYEESKNLPKVDSASQRESKEKQQPVVPKKREKEWKKKHAQARHKEYITAEELLAQREERGEEAIPQKILDLRGPQAKVLTNLENLNAEE EARDSDLSMPELQHNIRLIVDLAKLEIEEFDRKLRNERETVVALHREKEMLENEASLS* | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 13,875.648 | ||
Theoretical pI: | 9.598 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 44.689 | ||
aromaticity | 0.117 | ||
GRAVY | 0.198 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.383 | ||
sheet | 0.219 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EE297535.1 | complete | 128 | 607-221(-) |
Amino Acid sequence : | |||
MNVPAPVRSNNTTYLHHCNPVAFYEREASFSSISFSLCNATTVSRSFLSFLSNSSISSFARSTINLMLCCNSGMDKSLSLASSSAFKFSKFVNTLAWGPLKSRIFWGIASSPRSSLCASN SSAVIYSL* | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 13,875.648 | ||
Theoretical pI: | 9.598 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 44.689 | ||
aromaticity | 0.117 | ||
GRAVY | 0.198 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.383 | ||
sheet | 0.219 |