| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EE297535.1 | 5prime_partial | 178 | 3-539(+) |
Amino Acid sequence : | |||
| KGGGLGKNEQGIVAPIEAKLRPKKMGMGFNDYEESKNLPKVDSASQRESKEKQQPVVPKKREKEWKKKHAQARHKEYITAEELLAQREERGEEAIPQKILDLRGPQAKVLTNLENLNAEE EARDSDLSMPELQHNIRLIVDLAKLEIEEFDRKLRNERETVVALHREKEMLENEASLS* | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 13,875.648 | ||
| Theoretical pI: | 9.598 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 44.689 | ||
| aromaticity | 0.117 | ||
| GRAVY | 0.198 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.383 | ||
| sheet | 0.219 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EE297535.1 | complete | 128 | 607-221(-) |
Amino Acid sequence : | |||
| MNVPAPVRSNNTTYLHHCNPVAFYEREASFSSISFSLCNATTVSRSFLSFLSNSSISSFARSTINLMLCCNSGMDKSLSLASSSAFKFSKFVNTLAWGPLKSRIFWGIASSPRSSLCASN SSAVIYSL* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 13,875.648 | ||
| Theoretical pI: | 9.598 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 44.689 | ||
| aromaticity | 0.117 | ||
| GRAVY | 0.198 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.383 | ||
| sheet | 0.219 | ||