Acc_NO	ORF type	length	start-end position (strand +/-)
>EE297541.1	5prime_partial	210	3-635(+)
Amino Acid sequence :
AGPVIANVIIVENLFEVLTSSTSGRLQYPNYEKYLIGLERALKKLKSQSKSSLLSDLRSDKREKILEVDGTVTTQPVLQHVGVSTWPGRLTLTDHALYFEPLRVVSFDKAQRYDLDKDLK QVVKPEMTGPWGTRLFDKAVSYKSIFLSEPVLMEFPELKGNTRRDYWLAIIEEILLAHRFLXQFQLTGVEGEEALLLAVFGIYGYQPFKS*
Physicochemical properties
Number of amino acids:		210
Molecular weight:		23,812.185
Theoretical pI:		7.083
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		29910 29910
Instability index:		35.037
aromaticity		0.105
GRAVY		-0.143
Secondary Structure Fraction
Helix		0.378
turn		0.201
sheet		0.278