Acc_NO	ORF type	length	start-end position (strand +/-)
>EE297545.1	internal	151	454-2(-)
Amino Acid sequence :
SNVVVGLNDTMENLMASLERNESEISPSTIYALACVLENVPFINGSPQNTFVPGLIELAIKRNSLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKE ISKSNVVDDMVASNGILYEPGEHPDHVVVIK
Physicochemical properties
Number of amino acids:		151
Molecular weight:		16,233.251
Theoretical pI:		4.923
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		4470 4470
Instability index:		35.512
aromaticity		0.053
GRAVY		-0.047
Secondary Structure Fraction
Helix		0.318
turn		0.331
sheet		0.225