Acc_NO	ORF type	length	start-end position (strand +/-)
>EE297554.1	internal	219	658-2(-)
Amino Acid sequence :
IKAANMSGDETRKFRDLVLCDVTPLSLGCETFGGDFVVLIPRNTSIPCRKETSGSASVDNQTSRRIKIYEGERPRAEDNTLLGEFELSGYPPSQKGDPTVNICFDIDANGILNVTATENT TGMKKNITITSHAGRLLTDEIEKLLVKAKLYKAEDDAFNEKAKDKNALENYVYDLRNMVSDLKMTSELTMDRKMEIEDSLKSTLTWLDSSPLDKTDKME
Physicochemical properties
Number of amino acids:		219
Molecular weight:		24,458.381
Theoretical pI:		4.939
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 13200
Instability index:		36.536
aromaticity		0.055
GRAVY		-0.561
Secondary Structure Fraction
Helix		0.256
turn		0.224
sheet		0.269