Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EE297567.1 | 5prime_partial | 102 | 3-311(+) |
Amino Acid sequence : | |||
FFFFFFFFCLFDFYLCCCQTAPEAHSSLRTLHLPVASSISYYHTSLLHQAGYYPICLLLTHWLLPLRVIPQSSMIPERKPHEEEFSGHNPCNLDQHHRTIVS* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,991.708 | ||
Theoretical pI: | 6.507 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13325 | ||
Instability index: | 52.123 | ||
aromaticity | 0.167 | ||
GRAVY | 0.142 | ||
Secondary Structure Fraction | |||
Helix | 0.382 | ||
turn | 0.216 | ||
sheet | 0.235 |