Acc_NO	ORF type	length	start-end position (strand +/-)
>EE297598.1	internal	180	540-1(-)
Amino Acid sequence :
TRGPQHIAYLSLPLSIYHLLDPCVSEKMAMKLYGVPMSTCTSRVMACLHEKGADFELVPVNLGTGEHKQPPFLSKNPFGQIPVLEDGDLTLYESRAITAYVAEKCKETGTDLMRHKNPKE AAMVKVWMEVESQTFNPAISPIVMEYVIGPSMGKKTEQAVVDACTGKLGKVLDVYESRLS
Physicochemical properties
Number of amino acids:		180
Molecular weight:		19,861.910
Theoretical pI:		6.192
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15930 16180
Instability index:		48.022
aromaticity		0.067
GRAVY		-0.141
Secondary Structure Fraction
Helix		0.289
turn		0.228
sheet		0.289