Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EE297613.1 | internal | 174 | 524-3(-) |
Amino Acid sequence : | |||
AGVQKGWASLQAIPRTVLYDNKTGTNLNQWPVEEVESLRTNVHSVDNLTVEAGSVVPLNLSSASQLDVVAEFDIDPEALQNLPAANTHEHYNCSSLYDGAAHRGALGPFGLLVLANEDMT EHTPVYFYVAKASHGNFTTFFCTDLTRSSAAPDVIKDVFGSTVPVLKGEKLTVR | |||
Physicochemical properties | |||
Number of amino acids: | 174 | ||
Molecular weight: | 18,801.770 | ||
Theoretical pI: | 4.956 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
Instability index: | 35.166 | ||
aromaticity | 0.080 | ||
GRAVY | -0.113 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.253 | ||
sheet | 0.264 |