| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EE297640.1 | 5prime_partial | 102 | 1-309(+) |
Amino Acid sequence : | |||
| TSSFIGEFLILVGAFQRNSLVATLAALGMILGAAYSLWLYNRVVSGNLKPDFLHKFSDLNGREVFIFIPFLVGVVWMGVYPKVFLDCMHTSVSNLVQHGKFH* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,379.260 | ||
| Theoretical pI: | 8.930 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 22.994 | ||
| aromaticity | 0.147 | ||
| GRAVY | 0.653 | ||
Secondary Structure Fraction | |||
| Helix | 0.451 | ||
| turn | 0.245 | ||
| sheet | 0.245 | ||