Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EE297647.1 | complete | 104 | 60-374(+) |
Amino Acid sequence : | |||
MSSRSIGYSANEDRILCQVYIDISQNPITGNQQSSNQFWSRIEEAYNKSRTSTWEMRTTRSLQSQIQIIEKATRKLQSCIRQVENMHPSGASEQDIMDRTKVLL* | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 12,043.380 | ||
Theoretical pI: | 8.709 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 77.659 | ||
aromaticity | 0.058 | ||
GRAVY | -0.775 | ||
Secondary Structure Fraction | |||
Helix | 0.240 | ||
turn | 0.250 | ||
sheet | 0.192 |