| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EE297647.1 | complete | 104 | 60-374(+) |
Amino Acid sequence : | |||
| MSSRSIGYSANEDRILCQVYIDISQNPITGNQQSSNQFWSRIEEAYNKSRTSTWEMRTTRSLQSQIQIIEKATRKLQSCIRQVENMHPSGASEQDIMDRTKVLL* | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 12,043.380 | ||
| Theoretical pI: | 8.709 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 77.659 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.775 | ||
Secondary Structure Fraction | |||
| Helix | 0.240 | ||
| turn | 0.250 | ||
| sheet | 0.192 | ||