Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EE297675.1 | internal | 155 | 465-1(-) |
Amino Acid sequence : | |||
TFPPCVFISGFPSPLRATIFTDSQVTPETTSAAAAKSKVVFIMGATATGKSKLSIDIATHLQGCSSGAEIINSDKIQVYEGLDILTNKVTKEEMKGVPHHLLGHISNPDEDYPPERFTRD ALETLDVILKAGRLPIIVGGSNMYIEALVTSNVTG | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 16,544.732 | ||
Theoretical pI: | 5.495 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 34.552 | ||
aromaticity | 0.058 | ||
GRAVY | 0.032 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.258 | ||
sheet | 0.232 |