Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EE297680.1 | complete | 113 | 68-409(+) |
Amino Acid sequence : | |||
MLEGAKLMGAGAATIAFSGAAVGIGNVFSSLIHSVARNPSLAKQLVCYAILGFALTEAIALSALMMAFLDLIRILTPTHLIKLNFFLPGRAAPKGRIPANIHSTLGGRSHLCS* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 11,728.868 | ||
Theoretical pI: | 10.192 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 30.612 | ||
aromaticity | 0.062 | ||
GRAVY | 0.751 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.257 | ||
sheet | 0.363 |