Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EE297689.1 | internal | 150 | 450-1(-) |
Amino Acid sequence : | |||
NDSVRPNCKETKIHMSKSQVTPETTPTAAAKSKAVFIMGATATGKSKLSIDIATHLQGCSSGAEIINSDKIQVYEGLDILTNKTTREEMKGVPHHLLGHISNPDEDYPPERFTRDVLETL DVILKAGRLPIIVGRSNMYIEALVTSNVAA | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 16,271.396 | ||
Theoretical pI: | 6.572 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 35.418 | ||
aromaticity | 0.033 | ||
GRAVY | -0.277 | ||
Secondary Structure Fraction | |||
Helix | 0.260 | ||
turn | 0.240 | ||
sheet | 0.247 |